Structure of PDB 4p3w Chain E Binding Site BS02

Receptor Information
>4p3w Chain E (length=172) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAE
MGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVP
AEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYE
VSVKFNEEHIPDSPFVVPVASP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p3w Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G2223 P2225 F2226 Q2227 F2228 T2229 P2232 E2313 E2314 H2315 S2319
Binding residue
(residue number reindexed from 1)		G67 P69 F70 Q71 F72 T73 P76 E157 E158 H159 S163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4p3w, PDBe:4p3w, PDBj:4p3w
PDBsum4p3w
PubMed
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]