Structure of PDB 4c31 Chain E Binding Site BS02

Receptor Information

DTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNIN
ESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDT

Ligand information

KESIVL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	4c31 Structural Basis for Binding the Trex2 Complex to Nuclear Pores, Gal1 Localisation and Mrna Export.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	L8 Q11 Y15 I92 V93 D94
Binding residue (residue number reindexed from 1)	L5 Q8 Y12 I89 V90 D91

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0003713	transcription coactivator activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity

	Biological Process
GO:0000973	post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325	chromatin organization
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0006406	mRNA export from nucleus
GO:0015031	protein transport
GO:0016973	poly(A)+ mRNA export from nucleus
GO:0032880	regulation of protein localization
GO:0045893	positive regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051028	mRNA transport
GO:0071028	nuclear mRNA surveillance

	Cellular Component
GO:0000124	SAGA complex
GO:0000932	P-body
GO:0005634	nucleus
GO:0005643	nuclear pore
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0046695	SLIK (SAGA-like) complex
GO:0070390	transcription export complex 2
GO:0071819	DUBm complex

External links

PDB	RCSB:4c31, PDBe:4c31, PDBj:4c31
PDBsum	4c31
PubMed	24705649
UniProt	Q6WNK7\|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)