Structure of PDB 4by9 Chain E Binding Site BS02

Receptor Information
>4by9 Chain E (length=227) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVEVKKHKFPGVYVVIDDDGSEKIATKNLVPGQRVYGERVIKWEGEEYRI
WNPHRSKLGAAIVNGLKNFPIKPGKSVLYLGIASGTTASHVSDIVGWEGK
IYGIEFSPRVLRELVPIVEERRNIIPILGDATKPEEYRALVTKVDVIFED
VAQPTQAKILIDNAKAYLKRGGYGMIAVKSRSIDVTKEPEQVFKEVEREL
SEYFEVIERLNLEPYEKDHALFVVRKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4by9 The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
ResolutionN/A
Binding residue
(original residue number in PDB)		R55 S56 K57 A83 S84 T86 T87 K179 R181 H219
Binding residue
(residue number reindexed from 1)		R55 S56 K57 A83 S84 T86 T87 K179 R181 H219
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:0016740 transferase activity
GO:1990259 histone H2AQ104 methyltransferase activity
Biological Process
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006338 chromatin remodeling
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
Cellular Component
GO:0031428 box C/D methylation guide snoRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4by9, PDBe:4by9, PDBj:4by9
PDBsum4by9
PubMed24121435
UniProtQ8U4M2|FLPA_PYRFU Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (Gene Name=flpA)

[Back to BioLiP]