Structure of PDB 4a76 Chain E Binding Site BS02

Receptor Information

>4a76 Chain E (length=87) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEG
FRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN

Ligand information

>4a76 Chain F (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4a76 The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
Resolution	1.92 Å
Binding residue (original residue number in PDB)	W39 N41 M44 F48 D64 F66 H68 S93 K95
Binding residue (residue number reindexed from 1)	W13 N15 M18 F22 D38 F40 H42 S67 K69
Binding affinity	PDBbind-CN: Kd=59nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding

View graph for
Molecular Function

External links

PDB	RCSB:4a76, PDBe:4a76, PDBj:4a76
PDBsum	4a76
PubMed	22570413
UniProt	B4F6I0

[Back to BioLiP]