Structure of PDB 3zpl Chain E Binding Site BS02

Receptor Information
>3zpl Chain E (length=160) Species: 1902 (Streptomyces coelicolor) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKL
AESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQF
AILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQ
PSEADLPWLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zpl Investigation of DNA Sequence Recognition by a Streptomycete Marr Family Transcriptional Regulator Through Surface Plasmon Resonance and X-Ray Crystallography.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y44 S73 R74 H77 R81 K97 R98
Binding residue
(residue number reindexed from 1)		Y43 S72 R73 H76 R80 K96 R97
Binding affinityPDBbind-CN: Kd=2.4nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zpl, PDBe:3zpl, PDBj:3zpl
PDBsum3zpl
PubMed23748564
UniProtQ9KYU1

[Back to BioLiP]