Structure of PDB 3sl9 Chain E Binding Site BS02

Receptor Information
>3sl9 Chain E (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMR
SPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTN
VKFLAITTDCLQILA
Ligand information
>3sl9 Chain F (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DGLSQEQLEHRERSLQTLRDIQRMLFP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sl9 An intrinsically labile alpha-helix abutting the BCL9-binding site of beta-catenin is required for its inhibition by carnosic acid.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
E155 L159 D162 D164 V166 V167 K170 M174 L178
Binding residue
(residue number reindexed from 1)
E15 L19 D22 D24 V26 V27 K30 M34 L38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0045296 cadherin binding
Biological Process
GO:0007155 cell adhesion

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3sl9, PDBe:3sl9, PDBj:3sl9
PDBsum3sl9
PubMed22353711
UniProtP35222|CTNB1_HUMAN Catenin beta-1 (Gene Name=CTNNB1)

[Back to BioLiP]