Structure of PDB 3rej Chain E Binding Site BS02

Receptor Information
>3rej Chain E (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>3rej Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctccaaatatcccttgcggatcgtagaaaaagtgtgtcaaactgcgct
atcaaagggaaacttcaactgaattcagttgaagtttccctttgatagcg
cagtttgacacactttttctacgatccgcaagggatatttggagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rej Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
R40 Y41 R42 P43 T45 R63 R72 R83 F84 S86 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)
R2 Y3 R4 P5 T7 R25 R34 R45 F46 S48 R78 V79 T80 M82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3rej, PDBe:3rej, PDBj:3rej
PDBsum3rej
PubMed21724603
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]