Structure of PDB 3b6g Chain E Binding Site BS02

Receptor Information
>3b6g Chain E (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRI
RGERA
Ligand information
>3b6g Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3b6g Site selectivity of platinum anticancer therapeutics
Resolution3.45 Å
Binding residue
(original residue number in PDB)		G34 V35 K37 Y41 R42 P43 T45 R63 R72 R83 F84 Q85 S86 V117 T118 M120
Binding residue
(residue number reindexed from 1)		G4 V5 K7 Y11 R12 P13 T15 R33 R42 R53 F54 Q55 S56 V87 T88 M90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3b6g, PDBe:3b6g, PDBj:3b6g
PDBsum3b6g
PubMed18157123
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]