Structure of PDB 3aze Chain E Binding Site BS02

Receptor Information

>3aze Chain E (length=99) Species: 9606 (Homo sapiens)

KPHRYRPGTVALREIRRYQKSTELLIRQLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Ligand information

>3aze Chain J (length=144)

caatatccacctgcagattctaccaaaagtgtatttggaaactgctccat
caaaaggcatgttcagctgaattcagctgaacatgccttttgatggagca
gtttccaaatacacttttggtagaatctgcaggtggatattgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3aze Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): K37 H39 R40 Y41 R42 P43 R63 R72 R83 F84 Q85 S86 R116 T118
• Binding residue (residue number reindexed from 1): K1 H3 R4 Y5 R6 P7 R27 R36 R47 F48 Q49 S50 R80 T82

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0045296 cadherin binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0010467 gene expression
• GO:0032200 telomere organization
• GO:0040029 epigenetic regulation of gene expression

Cellular Component

• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3aze, PDBe:3aze, PDBj:3aze
• PDBsum: 3aze
• PubMed: 21812398
• UniProt: P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)