Structure of PDB 2ssp Chain E Binding Site BS02

Receptor Information

>2ssp Chain E (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDI
EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVS
WLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPASVYRGFFGC
RHFSKTNELLQKSGKKPIDWKEL

Ligand information

>2ssp Chain B (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaagataacag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ssp Base excision repair initiation revealed by crystal structures and binding kinetics of human uracil-DNA glycosylase with DNA.
Resolution	2.25 Å
Binding residue (original residue number in PDB)	P271 Y275
Binding residue (residue number reindexed from 1)	P190 Y194
Binding affinity	PDBbind-CN: Kd=19nM

Enzymatic activity

Enzyme Commision number

3.2.2.27: uracil-DNA glycosylase.

Gene Ontology

	Molecular Function
GO:0004844	uracil DNA N-glycosylase activity
GO:0016799	hydrolase activity, hydrolyzing N-glycosyl compounds

	Biological Process
GO:0006281	DNA repair
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2ssp, PDBe:2ssp, PDBj:2ssp
PDBsum	2ssp
PubMed	9724657
UniProt	P13051\|UNG_HUMAN Uracil-DNA glycosylase (Gene Name=UNG)

[Back to BioLiP]