Structure of PDB 1zr4 Chain E Binding Site BS02

Receptor Information

>1zr4 Chain E (length=183) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDL
LRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTD
SYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDA
VLNMWQQGLGASHISKTMNIARSTVYKVINESN

Ligand information

>1zr4 Chain W (length=3) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zr4 Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	R8 S10 R68 R130
Binding residue (residue number reindexed from 1)	R8 S10 R68 R130

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1zr4, PDBe:1zr4, PDBj:1zr4
PDBsum	1zr4
PubMed	15994378
UniProt	P03012\|TNR1_ECOLI Transposon gamma-delta resolvase (Gene Name=tnpR)

[Back to BioLiP]