Structure of PDB 1zg1 Chain E Binding Site BS02

Receptor Information
>1zg1 Chain E (length=66) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKL
KSRVEAAVWVHQERIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zg1 Primary and Secondary Modes of DNA Recognition by the NarL Two-Component Response Regulator.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T157 R159 I182 T183 S185 T186 H190
Binding residue
(residue number reindexed from 1)		T7 R9 I32 T33 S35 T36 H40
Binding affinityPDBbind-CN: Kd=0.45uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zg1, PDBe:1zg1, PDBj:1zg1
PDBsum1zg1
PubMed16262254
UniProtP0AF28|NARL_ECOLI Nitrate/nitrite response regulator protein NarL (Gene Name=narL)

[Back to BioLiP]