Structure of PDB 1z9o Chain E Binding Site BS02

Receptor Information
>1z9o Chain E (length=119) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCV
RPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPSDMEAVW
KEAKPDELMDSKLRCVFEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1z9o Structural basis of FFAT motif-mediated ER targeting
Resolution1.9 Å
Binding residue
(original residue number in PDB)		V44 K45 T46 T47 C53 V54 N57 K87 M89
Binding residue
(residue number reindexed from 1)		V40 K41 T42 T43 C49 V50 N53 K83 M85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005789 endoplasmic reticulum membrane

View graph for
Cellular Component
External links
PDB RCSB:1z9o, PDBe:1z9o, PDBj:1z9o
PDBsum1z9o
PubMed16004875
UniProtQ9Z270|VAPA_RAT Vesicle-associated membrane protein-associated protein A (Gene Name=Vapa)

[Back to BioLiP]