Structure of PDB 1ysh Chain E Binding Site BS02

Receptor Information
>1ysh Chain E (length=84) Species: 4530 (Oryza sativa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFR
LILVESRIHRLARYYKRTKKLPPTWKYESTTAST
Ligand information
>1ysh Chain B (length=101) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uagacggugggagagggugguggaauucccggaguagcggugaaaugcgc
agauaccgggaggaacgccgauggcgaaggcagccaccugguccacccgu
g
...<<<<<<<<...<<<<<<<....<<<<<<<.<..<<<......>>>..
...>.>>>>>>>...........<<....>>.>>>>>>>..>>>>>.>>>
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ysh Localization and dynamic behavior of ribosomal protein L30e
Resolution9.5 Å
Binding residue
(original residue number in PDB)		E83 I84 F90 I98 H101 N105 K107 D108 D110 S111 F113 R114 R121
Binding residue
(residue number reindexed from 1)		E19 I20 F26 I34 H37 N41 K43 D44 D46 S47 F49 R50 R57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ysh, PDBe:1ysh, PDBj:1ysh
PDBsum1ysh
PubMed15864315
UniProtQ69UI2|RS131_ORYSJ Small ribosomal subunit protein uS15z (Gene Name=Os08g0117200)

[Back to BioLiP]