Structure of PDB 1trr Chain E Binding Site BS02

Receptor Information
>1trr Chain E (length=104) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQQSPYSAAMAEQRHEEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREAL
GTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLE
EVLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1trr Tandem binding in crystals of a trp repressor/operator half-site complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
T44 D46
Binding residue
(residue number reindexed from 1)
T43 D45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1trr, PDBe:1trr, PDBj:1trr
PDBsum1trr
PubMed8232559
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]