Structure of PDB 1q3u Chain E Binding Site BS02

Receptor Information
>1q3u Chain E (length=321) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPED
VRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
RKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNT
LLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKL
VERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHR
LIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1q3u Crystal structure of a wild-type Cre recombinase-loxP synapse reveals a novel spacer conformation suggesting an alternative mechanism for DNA cleavage activation
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K43 M44 S47 R50 R81 L83 A84 K86 T87 A131 K132 Q156 R159 T202 R241 V242 R243 K244 L256 S257 R259 R282 W315 Y324
Binding residue
(residue number reindexed from 1)		K23 M24 S27 R30 R61 L63 A64 K66 T67 A111 K112 Q136 R139 T182 R221 V222 R223 K224 L236 S237 R239 R262 W295 Y304
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1q3u, PDBe:1q3u, PDBj:1q3u
PDBsum1q3u
PubMed12954782
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]