Structure of PDB 1p3p Chain E Binding Site BS02

Receptor Information
>1p3p Chain E (length=100) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ
SSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>1p3p Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p3p Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R642 P643 T645 R663 R672 R683 F684 Q685 S686 R716 V717 T718
Binding residue
(residue number reindexed from 1)
R7 P8 T10 R28 R37 R48 F49 Q50 S51 R81 V82 T83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1p3p, PDBe:1p3p, PDBj:1p3p
PDBsum1p3p
PubMed14739929
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]