Structure of PDB 1nkp Chain E Binding Site BS02

Receptor Information
>1nkp Chain E (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYM
RRKNHTHQQDIDDLKRQNALLEQQVRALGGC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nkp X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R704 H707 N708 E711 R712 R715 K719 S738 R739
Binding residue
(residue number reindexed from 1)		R1 H4 N5 E8 R9 R12 K16 S35 R36
Binding affinityPDBbind-CN: Kd=90nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1nkp, PDBe:1nkp, PDBj:1nkp
PDBsum1nkp
PubMed12553908
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]