Structure of PDB 1m18 Chain E Binding Site BS02

Receptor Information
>1m18 Chain E (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>1m18 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m18 Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
Resolution2.45 Å
Binding residue
(original residue number in PDB)
R640 Y641 R642 P643 T645 R663 R672 R683 F684 Q685 R716 V717 T718
Binding residue
(residue number reindexed from 1)
R4 Y5 R6 P7 T9 R27 R36 R47 F48 Q49 R80 V81 T82
Binding affinityPDBbind-CN: Kd=0.6uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1m18, PDBe:1m18, PDBj:1m18
PDBsum1m18
PubMed12559907
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]