Structure of PDB 7pua Chain Da Binding Site BS02

Receptor Information
>7pua Chain Da (length=36) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IAHWYCGHKFRHRFMRDKRFHPSLQASHDARNRFSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pua Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K18 F19 R20 H21 F23 M24 F43
Binding residue
(residue number reindexed from 1)		K9 F10 R11 H12 F14 M15 F34
Enzymatic activity
Enzyme Commision number ?
External links