Structure of PDB 4v9n Chain DZ Binding Site BS02

Receptor Information

>4v9n Chain DZ (length=187) Species: 262724 (Thermus thermophilus HB27)

YRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQAS
IHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPL
RFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHA
SDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAA

Ligand information

>4v9n Chain DB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<.....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>..>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): R10 P15 R19 R20 V27 Y29 N30 R31 N34 R72 Q73 N75 E84 H85 F89
• Binding residue (residue number reindexed from 1): R8 P13 R17 R18 V25 Y27 N28 R29 N32 R70 Q71 N73 E82 H83 F87

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
• PDBsum: 4v9n
• PubMed: 23769667
• UniProt: Q72IA7|RL25_THET2 Large ribosomal subunit protein bL25 (Gene Name=rplY)