Structure of PDB 4v4g Chain DW Binding Site BS02

Receptor Information
>4v4g Chain DW (length=173) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTG
LFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHT
TGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAG
DIKLPEGCTLAADPELTVVSVLP
Ligand information
>4v4g Chain DA (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccccgugcccauagcacuguggaaccaccccaccccaugccgaacuggg
ucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaaa
agucggucagcgcggggg
.<<<.<<<<.....<<.<<<<<....<<<<<<...............>>>
..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>...
....>>>..>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4g Structural basis for the control of translation initiation during stress.
Resolution11.5 Å
Binding residue
(original residue number in PDB)		R8 P10 K11 K13 L14 D15 A20 A21 V22 A23 Y24 N29 V30 S31 H80 Y84 Y88 G89 E90 P91 V92
Binding residue
(residue number reindexed from 1)		R8 P10 K11 K13 L14 D15 A20 A21 V22 A23 Y24 N29 V30 S31 H80 Y84 Y88 G89 E90 P91 V92
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 15:50:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v4g', asym_id = 'DW', bs = 'BS02', title = 'Structural basis for the control of translation initiation during stress.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v4g', asym_id='DW', bs='BS02', title='Structural basis for the control of translation initiation during stress.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '4v4g', asym_id = 'DW'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='4v4g', asym_id='DW')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>