Structure of PDB 6hiz Chain DT Binding Site BS02

Receptor Information

>6hiz Chain DT (length=239) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QADRRTRHHMMVDGQINPREWFNWHPKEYQPWYFDRHKFLYEQRQYAQFH
HLLCHQVYLKDMLHLMRYPEPYTHIIDCRTSTQKMHRWVPHSLWLPRDEV
EYALQLSADEFLDMYGFRKPDKSDDVILLSHNGIYSEQAGWEWKKQFFQH
VYNYRGGTNELFGESYSDMNVSDVLSPWKGPFPQSGVFVDKWSKRKVLTR
TGPFDRQYEMQDFALPDLELEKARHPEEGPRQNMPFGLQ

Ligand information

>6hiz Chain UO (length=5) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPPPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6hiz Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
Resolution	3.08 Å
Binding residue (original residue number in PDB)	H94 R95
Binding residue (residue number reindexed from 1)	H86 R87

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004792	thiosulfate sulfurtransferase activity

	Cellular Component
GO:0005739	mitochondrion
GO:0005763	mitochondrial small ribosomal subunit

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6hiz, PDBe:6hiz, PDBj:6hiz
PDBsum	6hiz
PubMed	30213880
UniProt	Q586G5

[Back to BioLiP]