Structure of PDB 4v97 Chain DS Binding Site BS02

Receptor Information

>4v97 Chain DS (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>4v97 Chain DB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v97 Reorganization of an intersubunit bridge induced by disparate 16S ribosomal ambiguity mutations mimics an EF-Tu-bound state.
• Resolution: 3.516 Å
• Binding residue (original residue number in PDB): R10 R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 T47 L54 N61 K62 T63 Y92 K93 H95 G96 R97
• Binding residue (residue number reindexed from 1): R9 R14 R24 F28 R29 S30 L31 K32 H33 Y35 Q37 T46 L53 N60 K61 T62 Y91 K92 H94 G95 R96

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v97, PDBe:4v97, PDBj:4v97
• PDBsum: 4v97
• PubMed: 23630274
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)