Structure of PDB 4v8i Chain DS Binding Site BS02

Receptor Information

>4v8i Chain DS (length=110) Species: 274 (Thermus thermophilus)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>4v8i Chain DB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v8i How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): R15 R25 F29 R30 S31 L32 K33 Y36 Q38 V46 T47 L54 A55 K62 T63 Y92 H95 G96 R97
• Binding residue (residue number reindexed from 1): R13 R23 F27 R28 S29 L30 K31 Y34 Q36 V44 T45 L52 A53 K60 T61 Y90 H93 G94 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8i, PDBe:4v8i, PDBj:4v8i
• PDBsum: 4v8i
• PubMed: 22605777
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)