Structure of PDB 4v7m Chain DS Binding Site BS02

Receptor Information

>4v7m Chain DS (length=98) Species: 300852 (Thermus thermophilus HB8)

KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

Ligand information

>4v7m Chain DB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<......<<<<<<<<.....<<.<<...............>>
...>>....>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>...>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v7m The structures of the anti-tuberculosis antibiotics viomycin and capreomycin bound to the 70S ribosome.
• Resolution: 3.45 Å
• Binding residue (original residue number in PDB): R17 R25 F29 L32 K33 H34 Q38 G45 V46 T47 S50 A55 G60 N61 K62 T63 Y92 H95 R97
• Binding residue (residue number reindexed from 1): R7 R15 F19 L22 K23 H24 Q28 G35 V36 T37 S40 A45 G50 N51 K52 T53 Y82 H85 R87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7m, PDBe:4v7m, PDBj:4v7m
• PDBsum: 4v7m
• PubMed: 20154709
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)