Structure of PDB 4v7l Chain DS Binding Site BS02

Receptor Information

>4v7l Chain DS (length=100) Species: 300852 (Thermus thermophilus HB8)

RRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKL
KGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

Ligand information

>4v7l Chain DB (length=118)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaaguaaacgcgccagcgccgaugguacugggcgggcgaccgccugggag
aguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<.....<<<<<...............>>
>..>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>...
>...>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v7l The structures of the anti-tuberculosis antibiotics viomycin and capreomycin bound to the 70S ribosome.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): R17 F29 S31 L32 K33 H34 Y36 Q38 T47 S50 N61 K62 T63 Y92 K93 H95
• Binding residue (residue number reindexed from 1): R9 F21 S23 L24 K25 H26 Y28 Q30 T39 S42 N53 K54 T55 Y84 K85 H87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7l, PDBe:4v7l, PDBj:4v7l
• PDBsum: 4v7l
• PubMed: 20154709
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)