Structure of PDB 4v5g Chain DS Binding Site BS02

Receptor Information

>4v5g Chain DS (length=98) Species: 300852 (Thermus thermophilus HB8)

KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

Ligand information

>4v5g Chain DB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<.....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<........<<<<<<<....>>>>>>>...
.....>>>..>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v5g The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): R17 R25 F29 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 S52 A55 K62 T63 Y92 K93 H95
• Binding residue (residue number reindexed from 1): R7 R15 F19 S21 L22 K23 H24 Y26 Q28 G35 V36 T37 S42 A45 K52 T53 Y82 K83 H85

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5g, PDBe:4v5g, PDBj:4v5g
• PDBsum: 4v5g
• PubMed: 19833920
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)