Structure of PDB 4v83 Chain DO Binding Site BS02

Receptor Information
>4v83 Chain DO (length=98) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
Ligand information
>4v83 Chain DB (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg
.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
R15 K19 R25 F29 R30 S31 L32 H34 Y36 Q38 G45 V46 T47 S50 A55 K62 T63 K93 H95 G96 R97
Binding residue
(residue number reindexed from 1)
R5 K9 R15 F19 R20 S21 L22 H24 Y26 Q28 G35 V36 T37 S40 A45 K52 T53 K83 H85 G86 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtQ72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]