Structure of PDB 4v7r Chain DE Binding Site BS02

Receptor Information
>4v7r Chain DE (length=287) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNK
DIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARR
TLQRLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGAR
VFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYM
EELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEK
KFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAG
Ligand information
>4v7r Chain D2 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<.....<<<<<<<<.....<<.<.................>..
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7r Crystal structure of the eukaryotic ribosome.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		R15 F16 Q17 T18 F20 R21 K27 T56 N57 T70 D72 V74 W95 T155 G156 A157 R158 Q206 E257 F260 E263 A266 A267 Y272 K276 L277 E280 A294 G295
Binding residue
(residue number reindexed from 1)		R7 F8 Q9 T10 F12 R13 K19 T48 N49 T62 D64 V66 W87 T147 G148 A149 R150 Q198 E249 F252 E255 A258 A259 Y264 K268 L269 E272 A286 G287
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7r, PDBe:4v7r, PDBj:4v7r
PDBsum4v7r
PubMed21109664
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]