BioLiP

Receptor Information

>5it7 Chain DD (length=295) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKYNTPKYRLV
VRFTNKDIITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATG
LLLARRTLQKLGLDETYPGVEEVEGEYELTEAVEDGPRPFKVYLDVGLQR
TTTGARIFGALKGASDGGLYVPHSENRFPGWDFEAEELDADLLRTYIFGG
HVSQYMEELADDDEERYRELFKGYLADDIDADAVEDIYADAHAAIREDPA
FKPTEKKFTKEQYAAESKKYRQVKLTREERKARVAAKISALAPQE

>5it7 Chain 7 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	K8 S10 H13 S14 Y16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 V52 R54 T56 N57 K58 I61 Q63 I69 G71 D72 V74 G91 N94 W95 R152 T154 T155 G156 A157 R158 P181 Y198 H203 Y207 E221 K224 F253 T256 F260 Y265 A266 E268 S269 Y272 R273 Q274 K276 R279 R282 V286 K289
Binding residue (residue number reindexed from 1)	K6 S8 H11 S12 Y14 T16 F18 R19 R20 R22 K25 T26 Y28 R31 R48 V50 R52 T54 N55 K56 I59 Q61 I67 G69 D70 V72 G89 N92 W93 R150 T152 T153 G154 A155 R156 P179 Y196 H201 Y205 E219 K222 F251 T254 F258 Y263 A264 E266 S267 Y270 R271 Q272 K274 R277 R280 V284 K287

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:5it7, PDBe:5it7, PDBj:5it7
PDBsum	5it7
PubMed	27159451
UniProt	Q6CRR9

[Back to BioLiP]

Structure of PDB 5it7 Chain DD Binding Site BS02