Structure of PDB 5tbw Chain DA Binding Site BS02

Receptor Information
>5tbw Chain DA (length=126) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKLE
Ligand information
>5tbw Chain AT (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R12 R13 R16 K17 F20 P23 S24 S25 R28 R51 R52 V73 Y74 R75 L111 D112 K113 D114 K116
Binding residue
(residue number reindexed from 1)
R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 R51 V72 Y73 R74 L110 D111 K112 D113 K115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
PDBsum5tbw
PubMed29064494
UniProtP05743|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)

[Back to BioLiP]