Structure of PDB 7ls2 Chain D1 Binding Site BS02

Receptor Information
>7ls2 Chain D1 (length=208) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLDRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAK
FKFPGRQKIHISKKWGFTKFNADEFEDKVAAKRLIPDGCGVKYIPERGPL
DKWRALHS
Ligand information
>7ls2 Chain B2 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ls2 Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y11 Y57 Y199 E202 R203 G204 P205 L206
Binding residue
(residue number reindexed from 1)		Y10 Y56 Y193 E196 R197 G198 P199 L200
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
GO:0007141 male meiosis I
GO:0007283 spermatogenesis
GO:0030154 cell differentiation
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ls2, PDBe:7ls2, PDBj:7ls2
PDBsum7ls2
PubMed34815424
UniProtP86048|RL10L_MOUSE Large ribosomal subunit protein uL16-like (Gene Name=Rpl10l)

[Back to BioLiP]