Structure of PDB 9gd3 Chain D Binding Site BS02

Receptor Information
>9gd3 Chain D (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>9gd3 Chain T (length=24) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTRFSNRQNKTVNYNIDYSDDDLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9gd3 Resolution of transcription-induced hexasome-nucleosome complexes by Chd1 and FACT.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q44 V45 E102 H106 E110
Binding residue
(residue number reindexed from 1)		Q16 V17 E74 H78 E82
External links
PDB RCSB:9gd3, PDBe:9gd3, PDBj:9gd3
PDBsum9gd3
PubMed39270644
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]