Structure of PDB 9c9m Chain D Binding Site BS02

Receptor Information

>9c9m Chain D (length=47) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII

Ligand information

>9c9m Chain O (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggaaaatctctagca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	9c9m HIV-1 Intasomes Assembled with Excess Integrase C-Terminal Domain Protein Facilitate Structural Studies by Cryo-EM and Reveal the Role of the Integrase C-terminal Tail in HIV-1 Integration
Resolution	2.01 Å
Binding residue (original residue number in PDB)	R228 R263
Binding residue (residue number reindexed from 1)	R7 R42

External links

PDB	RCSB:9c9m, PDBe:9c9m, PDBj:9c9m
PDBsum	9c9m
PubMed	39066328
UniProt	P12497\|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]