Structure of PDB 8zv9 Chain D Binding Site BS02

Receptor Information
>8zv9 Chain D (length=278) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRA
PWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMF
GCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEA
AHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEA
TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVV
PSGEEQRYTCHVQHEGLPKPLTLRWEPG
Ligand information
>8zv9 Chain F (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYNYLFRLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8zv9 Structural insights into immune escape at killer T cell epitope by SARS-CoV-2 Spike Y453F variants.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 H70 T73 N77 I80 Y84 L95 F99 Y116 Y123 T143 K146 W147 Q155 Q156 Y159 T163 Y171
Binding residue
(residue number reindexed from 1)		Y8 E64 K67 V68 H71 T74 N78 I81 Y85 L96 F100 Y117 Y124 T144 K147 W148 Q156 Q157 Y160 T164 Y172
External links