Structure of PDB 8z4l Chain D Binding Site BS02

Receptor Information
>8z4l Chain D (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8z4l Chain N (length=40) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cagaagaagcgcaccuaauuucgaauccagcaugagaagc
........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z4l Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.85 Å
Binding residue
(original residue number in PDB)
N36 F37 R77 M93 T118 T132 F133 K134
Binding residue
(residue number reindexed from 1)
N35 F36 R76 M92 T117 T131 F132 K133
External links