Structure of PDB 8yzt Chain D Binding Site BS02

Receptor Information
>8yzt Chain D (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLL
DYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDWYR
IKQSIDSKCRTAWRRKQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yzt Structural basis of DNA recognition by BEN domain proteins reveals a role for oligomerization in unmethylated DNA selection by BANP.
Resolution2.58 Å
Binding residue
(original residue number in PDB)
L253 S313 K314
Binding residue
(residue number reindexed from 1)
L47 S107 K108
External links
PDB RCSB:8yzt, PDBe:8yzt, PDBj:8yzt
PDBsum8yzt
PubMed39225042
UniProtQ8N9N5|BANP_HUMAN Protein BANP (Gene Name=BANP)

[Back to BioLiP]