Structure of PDB 8ylu Chain D Binding Site BS02

Receptor Information
>8ylu Chain D (length=213) Species: 2927983 (Salmonella phage Chi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVHKHIKANLCGKDADTTLFLTEGDSAIGYLIDVRDKELHGGYPLRGKVL
NSWGMSYADMLKNKELFDICAITGLVLGEKAENLNYHNIAIMTDADHDGL
GSIYPSLLGFFSNWPELFEQGRIRFVKTPVIIAHVGKKQEWFYTVAEYES
AKDALPKHSIRYIKGLGSLEKSEYREMIQNPVYDVVKLPENWKELFEMLM
GDNADLRKEWMSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ylu structure of phage T6 topoisomerase II central domain bound with DNA
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K396 G416 D417 S418 R438 G439 K440 D490 K556
Binding residue
(residue number reindexed from 1)		K4 G24 D25 S26 R46 G47 K48 D98 K164
External links