Structure of PDB 8wwy Chain D Binding Site BS02

Receptor Information
>8wwy Chain D (length=135) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPLTVLQVSLYHPTQGPVAFAHVPQQLQHDASRLLVGRGQNTHLQLQLPQ
LSRYHLSLEPYLEKGSSLLAFCLKVLTRKSCVWVNGLPLRYLEQVPLGTI
NRISFSGIQMLVRKEGGASLETFVCYFHLSPSPLI
Ligand information
Ligand IDHX2
InChIInChI=1S/C6H14O2/c1-5(7)3-4-6(2)8/h5-8H,3-4H2,1-2H3/t5-,6-/m1/s1
InChIKeyOHMBHFSEKCCCBW-PHDIDXHHSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.0C[C@H](CC[C@@H](C)O)O
CACTVS 3.370C[C@@H](O)CC[C@@H](C)O
ACDLabs 12.01OC(C)CCC(O)C
OpenEye OEToolkits 1.7.0CC(CCC(C)O)O
CACTVS 3.370C[CH](O)CC[CH](C)O
FormulaC6 H14 O2
Name(2R,5R)-hexane-2,5-diol
ChEMBL
DrugBank
ZINCZINC000000388716
PDB chain8wwy Chain D Residue 602 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wwy TIFAB regulates the TIFA-TRAF6 signaling pathway involved in innate immunity by forming a heterodimer complex with TIFA.
Resolution1.79 Å
Binding residue
(original residue number in PDB)
N87 L89 V97 P98
Binding residue
(residue number reindexed from 1)
N85 L87 V95 P96
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035800 deubiquitinase activator activity
Biological Process
GO:0002224 toll-like receptor signaling pathway
GO:0002244 hematopoietic progenitor cell differentiation
GO:0007356 thorax and anterior abdomen determination
GO:0010468 regulation of gene expression
GO:0021559 trigeminal nerve development
GO:0021650 vestibulocochlear nerve formation
GO:0030099 myeloid cell differentiation
GO:0030432 peristalsis
GO:0031223 auditory behavior
GO:0031663 lipopolysaccharide-mediated signaling pathway
GO:0035112 genitalia morphogenesis
GO:0042472 inner ear morphogenesis
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0048634 regulation of muscle organ development
GO:0048806 genitalia development
GO:0048839 inner ear development
GO:0050885 neuromuscular process controlling balance
GO:0071626 mastication
GO:0090102 cochlea development
GO:0090103 cochlea morphogenesis
GO:0097094 craniofacial suture morphogenesis
GO:0098583 learned vocalization behavior
GO:1901078 negative regulation of relaxation of muscle
GO:1902238 regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator
GO:1905747 negative regulation of saliva secretion
GO:1905748 hard palate morphogenesis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8wwy, PDBe:8wwy, PDBj:8wwy
PDBsum8wwy
PubMed38442163
UniProtQ8JZM6|TIFAB_MOUSE TRAF-interacting protein with FHA domain-containing protein B (Gene Name=Tifab)

[Back to BioLiP]