Structure of PDB 8rkg Chain D Binding Site BS02

Receptor Information
>8rkg Chain D (length=164) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFWDLEVKFTGQTSLLGMSEARQRGYQFSSDPYYLTVQASYSAFGLNVFN
LENQRLYVADLRLVSQFGSPRISIDTPMICARDSPSCNSTHATVLIPFFG
GVLTGINVNSVNIQLSSYSLQQHGITLDSRNGYRLYIKRSNDVLVLTFIY
YGKTVPMLISLVCS
Ligand information
>8rkg Chain O (length=28) Species: 8355 (Xenopus laevis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSSVVTCTKDSMTVRIPRTLSGFDDEIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rkg The vitelline envelope to fertilization envelope conversion in eggs of Xenopus laevis.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D195 Y197 Y198 L199 T200 V201 Q202 A203 Y205 T240 M242 C244 R246 P326 M327 L328 I329
Binding residue
(residue number reindexed from 1)		D31 Y33 Y34 L35 T36 V37 Q38 A39 Y41 T76 M78 C80 R82 P156 M157 L158 I159
Enzymatic activity
Enzyme Commision number ?
External links