Structure of PDB 8r0a Chain D Binding Site BS02

Receptor Information
>8r0a Chain D (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEK
VKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNK
INWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r0a Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution5.8 Å
Binding residue
(original residue number in PDB)		G95 R127 G128
Binding residue
(residue number reindexed from 1)		G94 R126 G127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r0a, PDBe:8r0a, PDBj:8r0a
PDBsum8r0a
PubMed38778104
UniProtP83876|TXN4A_HUMAN Thioredoxin-like protein 4A (Gene Name=TXNL4A)

[Back to BioLiP]