Structure of PDB 8r09 Chain D Binding Site BS02

Receptor Information
>8r09 Chain D (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEK
VKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNK
INWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r09 Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution4.3 Å
Binding residue
(original residue number in PDB)		G95 T96 G97 N98 N99 G128 S137
Binding residue
(residue number reindexed from 1)		G94 T95 G96 N97 N98 G127 S136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r09, PDBe:8r09, PDBj:8r09
PDBsum8r09
PubMed38778104
UniProtP83876|TXN4A_HUMAN Thioredoxin-like protein 4A (Gene Name=TXNL4A)

[Back to BioLiP]