Structure of PDB 8qa9 Chain D Binding Site BS02

Receptor Information
>8qa9 Chain D (length=107) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAV
SQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQETKR
KLAAALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qa9 Crystal structure of the RK2 plasmid encoded co-complex of the C-terminally truncated transcriptional repressor protein KorB complexed with the partner repressor protein KorA bound to OA-DNA
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E18 G20 Q22 T23 T47 A50 Q53 R57
Binding residue
(residue number reindexed from 1)		E17 G19 Q21 T22 T46 A49 Q52 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding

View graph for
Molecular Function
External links
PDB RCSB:8qa9, PDBe:8qa9, PDBj:8qa9
PDBsum8qa9
PubMed
UniProtP03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)

[Back to BioLiP]