Structure of PDB 8jkn Chain D Binding Site BS02

Receptor Information
>8jkn Chain D (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQNREEDAALFKA
WALFKGKFREGIDKPDPPTWKRRLRCALNKSNDFEELVERSQLDISDPYK
VYRIVPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jkn Molecular basis for the functional roles of the multimorphic T95R mutation of IRF4 causing human autosomal dominant combined immunodeficiency.
Resolution2.92 Å
Binding residue
(original residue number in PDB)
G22 L24 H56 K59 W74 K78 K80 R96 K103
Binding residue
(residue number reindexed from 1)
G1 L3 H35 K38 W51 K55 K57 R73 K80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8jkn, PDBe:8jkn, PDBj:8jkn
PDBsum8jkn
PubMed37683642
UniProtF2Z3D5

[Back to BioLiP]