Structure of PDB 8j90 Chain D Binding Site BS02

Receptor Information
>8j90 Chain D (length=90) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYN
KKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Ligand information
>8j90 Chain J (length=111) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgcctggagactagggagtaatccccttggcggttaaaacgcgggggaca
gcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgagc
ggcctcggcac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j90 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
Resolution4.71 Å
Binding residue
(original residue number in PDB)		T61 I64 Y65
Binding residue
(residue number reindexed from 1)		T2 I5 Y6
Gene Ontology
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0009534 chloroplast thylakoid
GO:0009570 chloroplast stroma

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8j90, PDBe:8j90, PDBj:8j90
PDBsum8j90
PubMed38992002
UniProtO23629|H2B6_ARATH Histone H2B.6 (Gene Name=H2B)

[Back to BioLiP]