Structure of PDB 8gdv Chain D Binding Site BS02

Receptor Information

>8gdv Chain D (length=209) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQ
DLNTMLNTVGGHQAAIQMLKETINEEAAEWDRLHPVPIAPGQMREPRGSD
IAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDI
RQGPKEPFRDYVDRFYKTLRAEQAATETLLVQNANPDCKTILKALGPGAT
LEEMMTACQ

Ligand information

>8gdv Chain Q (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8gdv Structure of M66I mutant of disulfide stabilized HIV-1 CA hexamer in complex with CPSF6 peptide and IP6
Resolution	3.3 Å
Binding residue (original residue number in PDB)	L172 T186
Binding residue (residue number reindexed from 1)	L169 T176

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:8gdv, PDBe:8gdv, PDBj:8gdv
PDBsum	8gdv
PubMed
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]