Structure of PDB 8e2p Chain D Binding Site BS02

Receptor Information
>8e2p Chain D (length=151) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIGLHDPT
AHAEIMALRQGGLVMQNYRLYDATLYSTFEPCVMCAGAMIHSRIGRVVFG
VRNAKTGAAGSLMDVLHHPGMNHRVEITEGILADECAALLCRFFRMPRRV
F
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e2p Improved cytosine base editors generated from TadA variants.
Resolution2.72 Å
Binding residue
(original residue number in PDB)		V30 N46 H57 E59 C87 N108 K110 F148 F149 R150 M151
Binding residue
(residue number reindexed from 1)		V25 N41 H52 E54 C82 N103 K105 F143 F144 R145 M146
Enzymatic activity
Enzyme Commision number 3.5.4.33: tRNA(adenine(34)) deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008251 tRNA-specific adenosine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0052717 tRNA-specific adenosine-34 deaminase activity
Biological Process
GO:0002100 tRNA wobble adenosine to inosine editing
GO:0006382 adenosine to inosine editing
GO:0008033 tRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8e2p, PDBe:8e2p, PDBj:8e2p
PDBsum8e2p
PubMed36624149
UniProtP68398|TADA_ECOLI tRNA-specific adenosine deaminase (Gene Name=tadA)

[Back to BioLiP]