Structure of PDB 8dwf Chain D Binding Site BS02

Receptor Information

>8dwf Chain D (length=349) Species: 1422 (Geobacillus stearothermophilus)

ETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSSVMLQQTRVET
VIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVK
TRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSR
LFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRP
SCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLI
RKRDSTGLLANLWEFPSCETDGKEKLEQMVGEQLQVELTEPIVSFEHAFS
HLVWQLTVFPGRLVHVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS

Ligand information

>8dwf Chain F (length=11)

tgtccaagtct

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8dwf Structural Basis for Base Engagement and Stereochemistry Revealed by Alteration of Catalytic Residue Glu43 in DNA Repair Glycosylase MutY
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): W30 L46 Q47 Q48 R50 V51 Y88 G122 G124 P125 Y126 T127 D144 G145 N146 R149 I191 R201 K228
• Binding residue (residue number reindexed from 1): W27 L43 Q44 Q45 R47 V48 Y85 G119 G121 P122 Y123 T124 D141 G142 N143 R146 I188 R198 K225

Enzymatic activity

• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Gene Ontology

Molecular Function

• GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0032357 oxidized purine DNA binding
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0035485 adenine/guanine mispair binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006298 mismatch repair
• GO:0006950 response to stress

External links

• PDB: RCSB:8dwf, PDBe:8dwf, PDBj:8dwf
• PDBsum: 8dwf
• UniProt: P83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)