Structure of PDB 8dfa Chain D Binding Site BS02

Receptor Information

>8dfa Chain D (length=286) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MTAIANRYEFVLLFDVENGNPNGDPDAGNMPRIDPETGHGLVTDVCLKRK
IRNHVALTKEGAERFNIYIQEKAILNETHERAYTACDLKPEPKKLPKKVE
DAKRVTDWMCTNFYDIRTFGAVMTTEVNCGQVRGPVQMAFARSVEPVVPQ
EVSITRMAVTTKAEAEDNRTMGRKHIVPYGLYVAHGFISAPLAEKTGFSD
EDLTLFWDALVNMFEHDRSAARGLMSSRKLIVFKHQNRLGNAPAHKLFDL
VKVSRAEGSSGPARSFADYAVTVGQAPEGVEVKEML

Ligand information

>8dfa Chain N (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcgccagcctgagcatgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8dfa Structural snapshots of R-loop formation by a type I-C CRISPR Cascade.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	K93 E126 R156 N172 M175 G176
Binding residue (residue number reindexed from 1)	K93 E126 R156 N168 M171 G172

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0043571	maintenance of CRISPR repeat elements

View graph for
Biological Process

External links

PDB	RCSB:8dfa, PDBe:8dfa, PDBj:8dfa
PDBsum	8dfa
PubMed	36805026
UniProt	Q72WF7

[Back to BioLiP]